PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g03970.1.p
Common NameBRADI_4g03970, LOC100838645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 355aa    MW: 40306 Da    PI: 10.1575
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g03970.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.6e-15655148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                      r+rW +eEd +l  +v+q+G++ W++++++m+  + R +k+c +rw +yl
  Bradi4g03970.1.p  6 RQRWRPEEDAILRAYVRQYGPREWSLVSQRMNvaLDRDAKSCLERWKNYL 55
                      89**********************************************97 PP

2Myb_DNA-binding35.62.2e-1161105147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +g+ T eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Bradi4g03970.1.p  61 KGSLTDEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 105
                       5778******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.667159IPR017930Myb domain
SMARTSM007171.6E-12557IPR001005SANT/Myb domain
SuperFamilySSF466893.37E-216100IPR009057Homeodomain-like
CDDcd001671.12E-7855No hitNo description
Gene3DG3DSA:1.10.10.607.1E-21862IPR009057Homeodomain-like
PfamPF139216.7E-14969No hitNo description
SMARTSM007175.0E-1060108IPR001005SANT/Myb domain
PROSITE profilePS5129418.68760110IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-1563104IPR009057Homeodomain-like
CDDcd001672.82E-665106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MQMKERQRWR PEEDAILRAY VRQYGPREWS LVSQRMNVAL DRDAKSCLER WKNYLRPGIK  60
KGSLTDEEQR LVIRLQAKHG NKWKKIAAEV PGRTAKRLGK WWEVFKEKQQ REIRDSRRPP  120
PEPSPDERGR YEWLLENFAE KLVKERQIAA PPAMAGGAPL LPPWMSSSNA VAMDVVGPLP  180
PPSPSVTLSL ASAAVSAPPP AAAAPWMQQQ QEAFGLVAAR VPAGDAMAEV AECCRELEEG  240
HRAWAAHRKE AAWRLKRVEL QLESERASRR REAAEEFEAK MRALWEEQAA AVERLEQEYR  300
DKVAGLRRDA ELKEQKMAEQ WASKHARLAK FVDQVAGASS CRRWPPGEMN GGGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-159103798MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-159103798C-Myb DNA-Binding Domain
1msf_C1e-159103798C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4434561e-162AB443456.1 Triticum aestivum WRS2 mRNA for Myb transcription factor, complete cds.
GenBankJF9519021e-162JF951902.1 Triticum aestivum clone TaMYB18 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758382.10.0PREDICTED: protein rough sheath 2
RefseqXP_003579268.10.0PREDICTED: protein rough sheath 2
SwissprotQ94IB11e-145RS2_ORYSJ; Protein rough sheath 2 homolog
TrEMBLI1IH970.0I1IH97_BRADI; Uncharacterized protein
STRINGBRADI4G03970.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Representative plantOGRP50961421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-108MYB family protein